Didaktik der Chemie / Universität Bayreuth

Stand: 19.06.17


Multimedia

8 Datenbanken: Lösungshinweise für die Übungen


Übung 1: Proteindatenbank, Bsp. menschliches Insulin. Zu:

5. Stark konserviert, z.B. GLY 8B und CYS 7B.

9. Alpha-helical A 16 AS; B 7 + 7

10. 3i40_A mol: protein length:
       21 Insulin A chain GIVEQCCTSICSLYQLENYCN;
       3i40_B mol: protein length:
       30 Insulin B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA;
       Proinsulin

.....................10........................ 20..................... 30........................ 40...................... 50
MALWMRLLPL LALLALWGPD PAAAFVNQHL CGSHLVEALY LVCGERGFFY 

......................60........................70...................... 80........................ 90................. 100
TPKTRREAED LQVGQVELGG GPGAGSLQPL ALEGSLQKRG IVEQCCTSIC

......................110
SLYQLENYCN

12. Disulfid-Brücken: CYS 20A und 19B; CYS 11 A und 6A; CYS 7A und 7B

14. Vergleich der Isoformen


Übung 2: Kopplung von Gen- und Proteindatenbank am Beispiel menschliche Amylase

Zu

5. Lage: auf Chromosom 1. 1p21.

6. Gen-Cluster: Amylase alpha-1 Speichel-Cluster.
    Halten Sie die EC-Nr. fest: 3.2.1.1.

8. Aminosäuresequenz: ganz unten
    AS-Sequenz in 1-Buchstaben-Code:

    1 xyssntqqgr tsivhlfewr wvdialecer ylapkgfggv qvsppnenva ihnpfrpwwe
  61 ryqpvsyklc trsgnedefr nmvtrcnnvg vriyvdavin hmcgnavsag tsstcgsyfn
121 pgsrdfpavp ysgwdfndgk cktgsgdien yndatqvrdc rlsglldlal gkdyvrskia
181 eymnhlidig vagfridask hmwpgdikai ldklhnlnsn wfpegskpfi yqevidlgge
241 pikssdyfgn grvtefkyga klgtvirkwn gekmsylknw gegwgfmpsd ralvfvdnhd
301 nqrghgagga siltfwdarl ykmavgfmla hpygftrvms syrwpryfen gkdvndwvgp
361 pndngvtkev tinpdttcgn dwvcehrwrq irnmvnfrnv vdgqpftnwy dngsnqvafg
421 rgnrgfivfn nddwtfsltl qtglpagtyc dvisgdking nctgikiyvs ddgkahfsis
481 nsaedpfiai haeskl.

9. Wechseln Sie zurück zur Startseite und starten Sie links über Genes & Expression und Gene die Gendatenbank Gene! Geben Sie den Gencode AMY1A[sym] AND „Homo sapiens“ ein. Stellen Sie fest, mit wie vielen Links Sie von dieser Seite aus die Länge des Gens (kein Klick: Fenster mit mouse over auf AMY1A unter genomic regions – genes: 13354 bp) und die Sequenz (1 Link, über das Tool-Symbol Hammer & Meißel und dann Sequence text view ) feststellen können.


Übung 3: Unterrichtsvorschläge zur Bioinformatik im Internet (vgl. [3])

Zu

2. z.B. http://de.wikipedia.org/wiki/Nukleotide D = Nicht-C

7. z. B. Homo – Pan troglodytes 355/25 von 180 AS; 1009/132 von 1141 Nukleotiden.

8. Stammbäume auf AS- und DNA-Ebene:


(vgl. http://extras.springer.com/2011/978-3-8274-2785-4/15_genetische-Analysen,
unter Graphiken Abb. 15.38 über Windows Fotoanzeige öffnen und dann kopierbar.


top

 

E-Mail: Walter.Wagner ät uni-bayreuth.de